CAMPSQ888
Title : Defensin
GenInfo Identifier : 37999545
Source : Dermacentor variabilis [American dog tick]
Taxonomy : Animalia, Arachnida
UniProt: Q86QI5
PubMed : 11439245
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
B. subtilis B. burgdorferi
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
Length : 36
Sequence:
 GFGCPLNQGACHNHCRSIRRRGGYCSGIIKQTCTCY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India