CAMPSQ872
Title : Puroindoline-A
GenInfo Identifier : 1709916
Source : Triticum aestivum [Wheat]
Taxonomy : Plantae
UniProt: P33432
PubMed : 16240178
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli ( MIC = 30 0.204 microg/ml ) , Staphylococcus aureus ( MIC = 30 0.408 microg/ml ), Agrobacterium tumefaciens ( MIC = 35 0.816 microg/ml ), Pseudomonas syringae phaseoli ( MIC = 50 0.689 microg/ml ) , Erwinia carotovora carotovora ( MIC = 50 0.258 microg/ml ), Clavibacter michiganensis ( MIC = 50 0.491 microg/ml )
Validated : Experimentally validated
Pfam : PF00234 : Tryp_alpha_amyl ( Protease inhibitor/seed storage/LTP family )
InterPro : IPR016140 : Bifunc_inhib/LTP/seed_store.
IPR013771 : Trypsin/amylase_inhib.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0016020 Cellular component Membrane IEA
GO:0045735 Molecular function Nutrient reservoir activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0005615 Cellular component Extracellular space IEA
GO:0016020 Cellular component Membrane IEA
GO:0045735 Molecular function Nutrient reservoir activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 118
Sequence:
 DVAGGGGAQQCPVETKLNSCRNYLLDRCSTMKDFPVTWRWWKWWKGGCQELLGECCSRLG
QMPPQCRCNIIQGSIQGDLGGIFGFQRDRASKVIQEAKNLPPRCNQGPPCNIPGTIGY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India