CAMPSQ853
Title : Hipposin
GenInfo Identifier : 37078647
Source : Hippoglossus hippoglossus [Atlantic halibut]
Taxonomy : Animalia, Pisces
UniProt: P59890
PubMed : 12637028
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Validated : Experimentally validated
InterPro : IPR009072 : Histone-fold.
IPR007125 : Histone_core_D.
IPR002119 : Histone_H2A.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0000786 Cellular component Nucleosome IEA
GO:0005634 Cellular component Nucleus IEA
GO:0003677 Molecular function DNA binding IEA
GO:0046982 Molecular function Protein heterodimerization activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 51
Sequence:
 SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India