CAMPSQ852
Title : Granulysin
GenInfo Identifier : 116242500
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P22749
PDB: 1L9L
Structure Database : CAMPST638
PubMed : 10644038
Activity : Antibacterial, Antifungal, Antiparasitic
Gram Nature : Gram +ve, Gram -ve
Target :
Mycobacterium tuberculosis
Validated : Experimentally validated
InterPro : IPR008138 : SapB_2.
IPR011001 : Saposin-like.
IPR008139 : SaposinB.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space TAS
GO:0097013 Cellular component Phagocytic vesicle lumen TAS
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0006968 Biological process Cellular defense response IDA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space TAS
GO:0097013 Cellular component Phagocytic vesicle lumen TAS
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0006968 Biological process Cellular defense response IDA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of another organism IDA
Length : 123
Sequence:
RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDK
PTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPST
GPL

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India