CAMPSQ850
Title : Dermaseptin-3
GenInfo Identifier : 29337224
Source : Phyllomedusa bicolor [Two-colored leaf frog]
Taxonomy : Animalia, Amphibia
UniProt: P81488
PubMed : 9540838
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
mollicutes ( MIC = 6.25 to 100 microM), firmicutes ( MIC = 6.25 to 100 microM), gracilicutes ( MIC = 6.25 to 100 microM)
Validated : Experimentally validated
Pfam : PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM
DermaseptinH30_5 HMM
DermaseptinH_57 HMM
DermaseptinP30_5 Pattern L-[FW]-K-[NT]-[ILM]-[IL]-K-G-[AI]-G-K-[LMV]-x-G-x-[ALV]-A-x-[GNQ]-x-[LV]-x(3)-[AGV]-[GQ]-[AP]-E-S
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 30
Sequence:
ALWKTIIKGAGKMIGSLAKNLLGSQAQPES

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India