CAMPSQ84
Title : Gastric inhibitory polypeptide
GenInfo Identifier : 121195
Source : Sus scrofa [pig]
Taxonomy : Animalia, Mammals
UniProt: P01281
PubMed : 8375398
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
B. megateriurn Bmll ( MIC = 0.24 microM ), S. pyogenes ( MIC = 3.9 microM ), E. coli D22 ( MIC = 3.8 microM )
Validated : Experimentally validated
Pfam : PF00123 : Hormone_2 ( Peptide hormone )
InterPro : IPR000532 : Glucagon_GIP_secretin_VIP.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0031769 Molecular function Glucagon receptor binding IBA
GO:0005179 Molecular function Hormone activity IEA
GO:0007189 Biological process Adenylate cyclase-activating G protein-coupled receptor signaling pathway IDA
GO:0038192 Biological process Gastric inhibitory peptide signaling pathway IDA
GO:0042304 Biological process Regulation of fatty acid biosynthetic process IEA
GO:0050796 Biological process Regulation of insulin secretion IEA
GO:0009749 Biological process Response to glucose IEA
GO:0042594 Biological process Response to starvation IBA
Length : 36
Sequence:
ISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India