CAMPSQ819
Title : Enterocin Q
GenInfo Identifier : 110832851
Source : Enterococcus faecium
Taxonomy : Monera
UniProt: Q7WYZ9
PubMed : Reference: Patel S, Stott I P, Bhakoo M, Elliott P (1988) Patenting computer-designed peptides. Journal of Computer-Aided Molecular Design, 12: 54:556.
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
Lactobacillus sakei 2714 , Enterococcus faecium P13
Validated : Experimentally validated
Comment : Inactive against Lactobacillus sakei 148 , Enterococcus faecium T136 , Pediococcus acidilactici 347 , Pediococcus pentosaceus FBB61
AMP Family : Bacteriocin
Length : 34
Sequence:
MNFLKNGIAKWMTGAELQAYKKKYGCLPWEKISC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India