| CAMPSQ8180 |
| Title : |
Antimicrobial peptide 1 (Fa-AMP1) |
| GenInfo Identifier : |
745997996 |
| Source : |
Fagopyrum esculentum [common buckwheat ] |
| Taxonomy : |
Plantae |
| UniProt: |
P0DKH7 |
| PubMed : |
12951494 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
Erwinia carotovora ( IC 50 = 11 microg/ml), Agrobacterium radiobacter ( IC 50 = 24 microg/ml), Agrobacterium rhizogenes ( IC 50 = 20 microg/ml), Clavibacter michiganensis ( IC 50 = 14 microg/ml), Curtobacterium flaccumfaciens ( IC 50 = 13 microg/ml), Fusarium oxysporum ( IC 50 = 19 microg/ml), Geotrichum candidum ( IC 50 = 36 microg/ml) |
| Validated : |
Experimentally validated |
| Pfam : |
PF00187 : Chitin_bind_1 ( Chitin recognition protein )
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0008061 |
Molecular function |
Chitin binding |
IEA |
| GO:0042742 |
Biological process |
Defense response to bacterium |
IEA |
| GO:0050832 |
Biological process |
Defense response to fungus |
IEA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
40 |
Sequence: |
AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK |
