CAMPSQ815
Title : Curvaticin
GenInfo Identifier : 110808192
Source : Lactobacillus curvatus
Taxonomy : Monera
UniProt: P84886
PubMed : 15752569
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
Listeria monocytogenes
Validated : Experimentally validated
Pfam : PF01721 : Bacteriocin_II ( Class II bacteriocin )
InterPro : IPR002633 : Bacteriocin_IIa.
IPR023388 : Bacteriocin_IIa_dom.
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM
BacteriocinH30_9 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0019835 Biological process Cytolysis IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
Length : 30
Sequence:
AYPGNGVHCGKYSCTVDKQTAIGNIGNNAA

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India