CAMPSQ814
Title : Enterocin SE-K4
GenInfo Identifier : 23503490
Source : Enterococcus faecalis
Taxonomy : Monera
UniProt: Q8GR39
PubMed : 16401077
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
B. subtilus ATCC 6633 [ at 40 degree ] , Clostridium beijerinckii JCM 1390 , Enterococcus faecium IFO 13712 , Enterococcus faecalis IFO 12964 , Listeria monocytogenes ATCC 15313
Validated : Experimentally validated
Comment : Inactive against B. subtilus ATCC 6633 ( at 37 degree) , Lactobacillus plantarum IFO 14711 ,Lactobacillus plantarum TISTR 541 , Lactococcus lactis IL 1403 , Leuconostoc mesenteroides TISTR 473 , Pediococcus acidilactici TISTR 952 , Staphylococcus aureus I
Pfam : PF01721 : Bacteriocin_II ( Class II bacteriocin )
InterPro : IPR002633 : Bacteriocin_IIa.
IPR023384 : Bacteriocin_IIa_CS.
IPR023388 : Bacteriocin_IIa_dom.
AMP Family : Bacteriocin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 43
Sequence:
 ATYYGNGVYCNKQKCWVDWSRARSEIIDRGVKAYVNGFTKVLG

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India