CAMPSQ805
Title : Bacteriocin 31
GenInfo Identifier : 498407133
Source : Enterococcus faecalis YI717
Taxonomy : Monera
UniProt: Q47778
PubMed : 8655558
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
E. hirae 9790, E. faecium, Listeria monocytogenes
Validated : Experimentally validated
Comment : Inactive against E. faecalis
Pfam : PF01721 : Bacteriocin_II ( Class II bacteriocin )
AMP Family : Bacteriocin
Signature :
ID Type Pattern / HMM
BacteriocinH35_7 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019835 Biological process Cytolysis IEA
GO:0042742 Biological process Defense response to bacterium IEA
Length : 43
Sequence:
ATYYGNGLYCNKQKCWVDWNKASREIGKIIVNGWVQHGPWAPR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India