CAMPSQ743
Title : Antimicrobial peptide Ar-AMP
GenInfo Identifier : 75284710
Source : Amaranthus retroflexus [Redroot amaranth]
Taxonomy : Plantae
UniProt: Q5I2B2
PubMed : 16126239
Activity : Antifungal
Target :
Fusarium culmorium Smith Sacc., Helminthosporium sativum Pammel., King et Bakke, Alternaria consortiale Fr., Botrytis cinerea Pers., Rhizoctonia solani K hn (caused morphological changes )
Validated : Experimentally validated
Pfam : PF00187 : Chitin_bind_1 ( Chitin recognition protein )
InterPro : IPR013006 : Antimicrobial_C6_CS.
IPR013006 :
IPR001002 : Chitin-bd_1.
IPR001002 :
IPR018371 : Chitin-binding_1_CS.
IPR018371 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0008061 Molecular function Chitin binding IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 30
Sequence:
 AGECVQGRCPSGMCCSQFGYCGRGPKYCGR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India