CAMPSQ741
Title : Antimicrobial peptide Alo-2
GenInfo Identifier : 41016818
Source : Acrocinus longimanus [Giant harlequin beetle]
Taxonomy : Animalia, Insects
UniProt: P83652
PubMed : 14661954
Activity : Antifungal
Target :
C. glabrata
Validated : Experimentally validated
Pfam : PF11410 : Antifungal_pept ( Antifungal peptide )
InterPro : IPR013006 : Antimicrobial_C6_CS.
IPR009101 : Gurmarin/antifun_pep.
IPR024206 : Gurmarin/antimicrobial_peptd.
AMP Family : Gurmarin
Signature :
ID Type Pattern / HMM
GurmarinH34_4 HMM
GurmarinH_10 HMM
GurmarinP34_4 Pattern C-I-x(3)-[DN]-G-C-Q-P-[DS]-G-x-Q-G-N-C-C-S-x-[HY]-C-H-K-E-P-G-W-V-[AT]-G-Y-C-[KR]
GurmarinP_10 Pattern C-I-x(3)-[DGN]-x-C-[NQ]-x-[DNS]-[AGV]-x-[PQ]-[GNP]-x-C-C-S-x-[FHY]-C-x(4)-[GN]-x-[GSV]-x-G-x-C-[KR]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 34
Sequence:
CIANRNGCQPDGSQGNCCSGYCHKEPGWVAGYCR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India