CAMPSQ68
Title : Drosomycin
GenInfo Identifier : 1169363
Source : Drosophila melanogaster [Fruit fly]
Taxonomy : Animalia, Insects
UniProt: P41964
PDB: 1MYN
Structure Database : CAMPST393
PubMed : 7806546
Activity : Antifungal
Target :
N. crassa ( IC50 = 0.6 microM), B. cinerea ( IC50 = 1.2 microM), F. culmorum ( IC50 = 1.0 microM ), A. brassicola ( IC50 = 0.9 microM), A. longipes (IC 50 1.4 microM), N . haematococca ( IC50 = 1.8 microM), F. oxysporum( IC50 = 4.2 microM), A. pisi ( IC50 = 3.2 microM)
Validated : Experimentally validated
InterPro : IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IDA
GO:0019731 Biological process Antibacterial humoral response TAS
GO:0019732 Biological process Antifungal humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0006952 Biological process Defense response IDA
GO:0050832 Biological process Defense response to fungus IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium TAS
GO:0042832 Biological process Defense response to protozoan IDA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0009617 Biological process Response to bacterium IDA
GO:0009611 Biological process Response to wounding IEP
Length : 44
Sequence:
 DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India