CAMPSQ6743
Title : Dermaseptin sVIII
GenInfo Identifier : 31414405
Source : Phyllomedusa sauvagei [Sauvage's leaf frog]
Taxonomy : Animalia, Amphibia
UniProt: Q7T3K7
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF12121 : DD_K ( Dermaseptin )
PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
IPR004275 :
IPR022731 : Dermaseptin.
IPR022731 :
AMP Family : Dermaseptin
Signature :
ID Type Pattern / HMM
DermaseptinH_57 HMM
DermaseptinH28_12 HMM
DermaseptinH31_4 HMM
DermaseptinH34_2 HMM
DermaseptinP31_4 Pattern A-[LM]-W-K-[DT]-[MV]-L-K-K-[IL]-G-T-[MV]-A-L-H-A-G-K-A-A-[FL]-G-A-[AV]-A-D-T-I-S-Q
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 79
Sequence:
 MDILKKSLFLVLFLGLVSLSICEEEKRENEDEEKQEDDEQSEMKRALWKTMLKKLGTVAL
HAGKAALGAAADTISQGAQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India