CAMPSQ674
Title : Defensin
GenInfo Identifier : 28864187
Source : Rhipicephalus microplus [Cattle tick]
Taxonomy : Animalia, Arachnida
UniProt: Q86LE4
PubMed : 14642886
Activity : Antibacterial
Gram Nature : Gram +ve
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium ISS
GO:0050830 Biological process Defense response to Gram-positive bacterium ISS
GO:0045087 Biological process Innate immune response IEA
Length : 38
Sequence:
GFGCPFNQGACHRHCRSIRRRGGYCAGLIKQTCTCYRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India