CAMPSQ671
Title : Antimicrobial peptide D2
GenInfo Identifier : 26393023
Source : Spinacia oleracea [Spinach]
Taxonomy : Plantae
UniProt: P81571
PubMed : 9762899
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Clavibacter michiganensis, Ralstonia solanacearum, F.culmorum
Validated : Experimentally validated
InterPro : IPR008177 : G_Purothionin.
IPR008176 : Gamma-thionin.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinH24_5 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of another organism IEA
Length : 52
Sequence:
 GIFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India