CAMPSQ6613
Title : Defensin alpha 10
GenInfo Identifier : 74271915
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: Q4JEI4
Activity : Antimicrobial
Validated : Predicted (Based on signature)
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
PF00879 : Defensin_propep ( Defensin propeptide )
Signature :
ID Type Pattern / HMM
DefensinH32_11 HMM
Signature :
ID Type Pattern / HMM
CAMPDefH32 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space ISO
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0071222 Biological process Cellular response to lipopolysaccharide ISO
GO:0042742 Biological process Defense response to bacterium ISO
GO:0050832 Biological process Defense response to fungus IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium ISO
GO:0050830 Biological process Defense response to Gram-positive bacterium ISO
GO:0002227 Biological process Innate immune response in mucosa IBA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0051673 Biological process Membrane disruption in other organism IBA
GO:0009410 Biological process Response to xenobiotic stimulus ISO
Length : 91
Sequence:
MRTLTLLTALLLLALHTQAESPQGSPKEAPDQEQLDMEDQDISVFFGGDKGTALQDAAGS
TCSCRIGTCVSGEWLSWVCRINGRIYRLCCR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India