CAMPSQ632
Title : Neutrophil defensin 2
GenInfo Identifier : 7993923
Source : Macaca mulatta [Rhesus macaque]
Taxonomy : Animalia, Mammals
UniProt: P82317
PubMed : 10531277
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
L.monocytogenes, S.aureus, C.neoformans
Validated : Experimentally validated
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
InterPro : IPR006080 : Defensin_beta/neutrophil.
IPR006081 : Mammalian_defensins.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinP30_10 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL]
DefensinH30_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 30
Sequence:
ACYCRIPACLAGERRYGTCFYMGRVWAFCC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India