CAMPSQ624
Title : SU ASABF
GenInfo Identifier : 74834686
Source : Ascaris suum [Pig roundworm]
Taxonomy : Animalia, Nematode
UniProt: P90683
PDB: 2D56
Structure Database : CAMPST372
PubMed : 8940016
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli JM109 ( IC50 = 50 microg/ml) , Proteus vulgaris ATCC 13315 ( IC50 = 10 microg/ml), Staphylococcus aureus ATCC6538P ( IC50 = 0.6 microg/ml), Bacillus subtilis ATCC6633 ( IC50 = 1.2 microg/ml), Micrococcus luteus ATCC398 ( IC50 = 0.8 microg/ml)
Validated : Experimentally validated
Pfam : PF16839: Antimicrobial25
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0098542 Biological process Defense response to other organism IEA
Length : 72
Sequence:
AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGRGGGEWPS
VPMPKGRSSRGR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India