CAMPSQ623
Title : Defensin ARD1
GenInfo Identifier : 74834657
Source : Archaeoprepona demophon [One-spotted leafwing butterfly]
Taxonomy : Animalia, Insects
UniProt: P84156
PDB: 1OZZ, 1P00, 1P0A
Structure Database : CAMPST394, CAMPST395, CAMPST396
PubMed : 14978308
Activity : Antifungal
Target :
C. albicans, C. neoformans A, A. fumigatus
Validated : Experimentally validated
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
IPR002061 : Scorpion_toxinL/defesin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region TAS
GO:0019732 Biological process Antifungal humoral response IDA
GO:0006952 Biological process Defense response TAS
GO:0045087 Biological process Innate immune response IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 44
Sequence:
 DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFANVNCWCET

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India