CAMPSQ621
Title : Opiscorpine-1
GenInfo Identifier : 74782548
Source : Opistophthalmus carinatus [African yellow leg scorpion]
Taxonomy : Animalia, Arachnida
UniProt: Q5WR03
PubMed : 15241551
Activity : Antibacterial, Antifungal
Gram Nature : Gram -ve
Target :
F.culmorum, F.oxysporum P.aeruginosa, E.coli
Validated : Experimentally validated
Pfam : PF14866 : Toxin_38 ( Potassium channel toxin )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 76
Sequence:
KWFNEKSIQNKIDEKIGKNFLGGMAKAVVHKLAKNEFMCVANVDMTKSCDTHCQKASGEK
GYCHGTKCKCGVPLSY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India