CAMPSQ565
Title : Antimicrobial peptide 1
GenInfo Identifier : 6226952
Source : Phytolacca americana [American pokeweed]
Taxonomy : Plantae
UniProt: P81418
PDB: 1DKC
Structure Database : CAMPST11
PubMed : 10759497
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
Filamentous fungii, Gram +ve bacteria
Validated : Experimentally validated
Comment : Inactive against Gram -ve bacteria such as E. coli and fungi like yeast
Pfam : PF11410 : Antifungal_pept ( Antifungal peptide )
InterPro : IPR013006 : Antimicrobial_C6_CS.
IPR009101 : Gurmarin/antifun_pep.
IPR024206 : Gurmarin/antimicrobial_peptd.
AMP Family : Gurmarin
Signature :
ID Type Pattern / HMM
GurmarinH_10 HMM
GurmarinP_10 Pattern C-I-x(3)-[DGN]-x-C-[NQ]-x-[DNS]-[AGV]-x-[PQ]-[GNP]-x-C-C-S-x-[FHY]-C-x(4)-[GN]-x-[GSV]-x-G-x-C-[KR]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 38
Sequence:
AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India