| CAMPSQ5603 |
| Title : |
NsuA2 |
| GenInfo Identifier : |
130845708 |
| Source : |
Streptococcus agalactiae |
| Taxonomy : |
Monera |
| UniProt: |
D2CGP4 |
| Activity : |
Antimicrobial |
| Validated : |
Predicted (Based on signature) |
| Pfam : |
PF02052 : Gallidermin ( Gallidermin )
|
| InterPro : |
IPR006079 : Lan.
IPR006079 :
|
| Signature : |
| ID |
Type |
Pattern / HMM |
|
BacteriocinH32_6 |
HMM |
 |
|
| Signature : |
| ID |
Type |
Pattern / HMM |
|
CAMPBacH32 |
HMM |
 |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0005102 |
Molecular function |
Signaling receptor binding |
IEA |
| GO:0019835 |
Biological process |
Cytolysis |
IEA |
| GO:0042742 |
Biological process |
Defense response to bacterium |
IEA |
|
| Length : |
55 |
Sequence: |
MNNEDFNLDLIKISKENNSGASPRVTSKSLCTPGCKTGILMTCPLKTATCGCHFG |