| CAMPSQ5525 |
| Title : |
Maximins 5/H4 |
| GenInfo Identifier : |
169730562 |
| Source : |
Bombina microdeladigitora [Hubei firebelly toad] |
| Taxonomy : |
Animalia, Amphibia |
| UniProt: |
C3RTJ4 |
| PubMed : |
21338048 |
| Activity : |
Antimicrobial |
| Validated : |
Predicted (Based on signature) |
| Pfam : |
PF05298 : Bombinin ( Bombinin )
|
| InterPro : |
IPR007962 : Bombinin.
IPR007962 :
|
| Signature : |
| ID |
Type |
Pattern / HMM |
|
CAMPMaxP27 |
Pattern |
I-G-x(3)-L-[GS]-[AGV]-[GLV]-[KR]-x(2)-[FL]-K-G-[AL]-x(3)-L-A-x(2)-[FY]-[ALV] |
|
CAMPMaxH |
HMM |
 |
|
CAMPMaxH27 |
HMM |
 |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0042742 |
Biological process |
Defense response to bacterium |
IEA |
|
| Length : |
145 |
Sequence: |
MNFKYIVAVSFLIASAYARSVQNDEQSLSQRDVLEEESLREIRSIGAKILGGVKTFFKGA LKELASTYLQQKRTAEEQHKVMKRLEAVMRDLDSLDHPEEASERETRGFNQEEIANLFTK KEKRILGPVISKIGGVLGGLLKNLG |