CAMPSQ537
Title : Defensin
GenInfo Identifier : 585042
Source : Pyrrhocoris apterus [Sap sucking bug]
Taxonomy : Animalia, Insects
UniProt: P37364
PubMed : 8002963
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
M.luteus, B.megaterium, A.viridans, S.aureus and S.saprophyticus, P.acidilactici, B.subtilis QB935, E.coli D22
Validated : Experimentally validated
Pfam : PF01097 : Defensin_2 ( Arthropod defensin )
InterPro : IPR001542 : Defensin_invertebrate/fungal.
IPR003614 : Scorpion_toxin-like.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0045087 Biological process Innate immune response IEA
Length : 43
Sequence:
 ATCDILSFQSQWVTPNHAGCALHCVIKGYKGGQCKITVCHCRR

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India