CAMPSQ535
Title : Bacteriocin carnobacteriocin BM1
GenInfo Identifier : 584889
Source : Carnobacterium maltaromaticum
Taxonomy : Monera
UniProt: P38579
PubMed : 8163526
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
C. divergens LV13 ( MIC = 93 microg/ml), C. piscicola UAL26 ( MIC = 128 microg/ml), Lactobacillus plantarum ATCC 4008 ( MIC = 8 microg/ml), Pediococcus parvulus ATCC 19371 ( MIC = 8 microg/ml), Listeria monocytogenes ATCC 15313 ( MIC = 64 microg/ml), Listeria innocua ATCC 33090 ( MIC = 32 microg/ml), Enterococcus faecium ATCC 11576 ( MIC = 16 microg/ml), Enterococcus faecalis ATCC 19433 ( MIC = 32 microg/ml), E. faecium ATCC 19434 ( MIC = 8 microg/ml)
Validated : Experimentally validated
Pfam : PF01721 : Bacteriocin_II ( Class II bacteriocin )
InterPro : IPR002633 : Bacteriocin_IIa.
IPR023384 : Bacteriocin_IIa_CS.
IPR023388 : Bacteriocin_IIa_dom.
IPR010133 : Bacteriocin_signal_seq.
AMP Family : Bacteriocin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0001897 Biological process Cytolysis by symbiont of host cells IDA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0051712 Biological process Positive regulation of killing of cells of other organism IDA
Length : 43
Sequence:
 AISYGNGVYCNKEKCWVNKAENKQAITGIVIGGWASSLAGMGH

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India