| CAMPSQ518 |                                 
			  
                
				
								| Title : | 
                                Bacteriocin pediocin PA-1 precursor  |                                 
			  
			                                
                                | GenInfo Identifier : | 
                                548575 | 
							
                                                                                    
								| Source : | 
                                Pediococcus acidilactici  |                                 
							
                                                      
                                                        
								| Taxonomy : | 
                                Monera | 
              
                                								                                                            
                                | UniProt: | 
                                P29430 | 
							
                                                                                                                                            
                            	| PubMed : | 
                                1514784, 29899567 | 
                            
                                                        
								| Activity : | 
                                Antibacterial |                                 
							
                                                        
								| Gram Nature : | 
                                Gram +ve | 
                            
                                                                                    
                                | Target : | 
                                Lactobacillus bifermentum 35409 , Lactobacillus casei subsp. casei NCIB 4114, Lactobacillus casei 842, Lactobacillus plantarum WSO, Lactobacillus plantarum 8014, Leuconostoc dextranicum Lde 1.0, Pediococcus acidilactici 25742, Pediococcus pentosaceus PMR,   | 
							
                                                                                                                    
                                | Validated : | 
                                Experimentally validated | 
							
                                                                                    
                                | Comment : | 
                            	Inactive against Lactococcus lactis subsp. lactis ML 3, Staphylococcus aureus 288 | 
              
                                                                
                            
                                | Pfam : | 
                                
								
  
  
								
								  
  
    
   PF01721    : Bacteriocin_II    ( Class II bacteriocin )   
        							 | 
							
                                                              
                            
                                | InterPro : | 
                                
								
  
  
								
								IPR002633    : Bacteriocin_IIa.    
  
        IPR002633    :     
  
        IPR023384    : Bacteriocin_IIa_CS.    
  
        IPR023384    :     
  
        IPR023388    : Bacteriocin_IIa_dom.    
  
        IPR023388    :     
  
        IPR010133    : Bacteriocin_signal_seq.    
  
        IPR010133    :     
  
        							 | 
							
                            							
							
                                                        
                                | AMP Family : | 
                                Bacteriocin | 
							
                                                                                    
                                | Signature : | 
                                
								
					  
					    | ID | 
					 
                        Type | 
                       
					    Pattern / HMM | 
					     
                     
								                                            
                                            | 
                                            BacteriocinH30_9 | 
                                            
                                            HMM  | 
                                            
                                              | 
                                   
                                         
                                                                            | 
							
                                                        
                            
                            
                                                                                    
                            
                                                        
                                | Gene Ontology : | 
                                
								
  
    | GO ID | 
    Ontology | 
    Definition | 
    Evidence  | 
   
 
																 
    							| GO:0005576 | 
   								 Cellular component | 
   								 Extracellular region | 
   								 IEA | 
 								  
																 
    							| GO:0019835 | 
   								 Biological process | 
   								 Cytolysis | 
   								 IEA | 
 								  
																 
    							| GO:0042742 | 
   								 Biological process | 
   								 Defense response to bacterium | 
   								 IEA | 
 								  
																 
    							| GO:0005576 | 
   								 Cellular component | 
   								 Extracellular region | 
   								 IEA | 
 								  
																 
    							| GO:0019835 | 
   								 Biological process | 
   								 Cytolysis | 
   								 IEA | 
 								  
																 
    							| GO:0042742 | 
   								 Biological process | 
   								 Defense response to bacterium | 
   								 IEA | 
 								  
																 								 | 
							
                                                        
                                | Length : | 
                                44 | 
							
                                                        
                
    Sequence:  | 
    KYYGNGVTCGKHSCSVDWGKATTCIINNGAMAWATGGHQGNHKC |