CAMPSQ502
Title : Histone H2B type 1-K
GenInfo Identifier : 51701495
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: O60814
PubMed : 15019208
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
E. coli ( MIC = 10 microg/ml)
Validated : Experimentally validated
Pfam : PF00125 : Histone ( Core histone H2A/H2B/H3/H4 )
InterPro : IPR009072 : Histone-fold.
IPR007125 : Histone_core_D.
IPR000558 : Histone_H2B.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005829 Cellular component Cytosol IDA
GO:0005615 Cellular component Extracellular space IDA
GO:0005654 Cellular component Nucleoplasm IDA
GO:0000786 Cellular component Nucleosome IEA
GO:0005634 Cellular component Nucleus IDA
GO:0003677 Molecular function DNA binding IBA
GO:0046982 Molecular function Protein heterodimerization activity IEA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0006334 Biological process Nucleosome assembly IBA
Length : 125
Sequence:
 PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMG
IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSAK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India