| CAMPSQ4860 |
| Title : |
CEC-A |
| GenInfo Identifier : |
156535932 |
| Source : |
Anopheles merus [Mosquito] |
| Taxonomy : |
Animalia, Insects |
| UniProt: |
A7XB42 |
| Activity : |
Antimicrobial |
| Validated : |
Predicted (Based on signature) |
| Pfam : |
PF00272 : Cecropin ( Cecropin family )
|
| InterPro : |
IPR000875 : Cecropin.
IPR000875 :
|
| Signature : |
| ID |
Type |
Pattern / HMM |
|
CAMPCecP35 |
Pattern |
K-[ILV]-x-K-K-I-E-x(2)-G-x(0,1)-R-[NV]-[FIV]-[KR]-[ADN]-[AG]-x(3)-[AL]-[AGP]-[PV]-[AV]-[AIV]-[AEG]-V-x-[AG]-x-[AG] |
|
CAMPCecH |
HMM |
 |
|
CAMPCecH35 |
HMM |
 |
|
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0005576 |
Cellular component |
Extracellular region |
IEA |
| GO:0019731 |
Biological process |
Antibacterial humoral response |
IEA |
| GO:0050829 |
Biological process |
Defense response to Gram-negative bacterium |
IEA |
| GO:0050830 |
Biological process |
Defense response to Gram-positive bacterium |
IEA |
| GO:0045087 |
Biological process |
Innate immune response |
IEA |
|
| Length : |
58 |
Sequence: |
MNFSKIFIFVVLAVLLLCSQTEAGRLKKLGKKIEGVGKRVFKAAEKALPVVAGVKALG |