CAMPSQ4405
Title : Haptoglobin beta chain
Source : Rattus norvegicus [Rat]
Taxonomy : Animalia, Mammals
UniProt: P06866
PubMed : 6863267
Activity : Antibacterial
Validated : Predicted
Pfam : PF00089 : Trypsin ( Trypsin )
InterPro : IPR008292 : Haptoglobin.
IPR001254 : Peptidase_S1.
IPR001314 : Peptidase_S1A.
IPR000436 : Sushi_SCR_CCP.
IPR009003 : Trypsin-like_Pept_dom.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0072562 Cellular component Blood microparticle IDA
GO:0005783 Cellular component Endoplasmic reticulum IDA
GO:0005615 Cellular component Extracellular space IDA
GO:0005794 Cellular component Golgi apparatus IDA
GO:0031838 Cellular component Haptoglobin-hemoglobin complex ISO
GO:0016209 Molecular function Antioxidant activity IEA
GO:0030492 Molecular function Hemoglobin binding IDA
GO:0042802 Molecular function Identical protein binding IPI
GO:0004252 Molecular function Serine-type endopeptidase activity IBA
GO:0002526 Biological process Acute inflammatory response IEP
GO:0006953 Biological process Acute-phase response IEA
GO:0007568 Biological process Aging IEP
GO:0031100 Biological process Animal organ regeneration IEP
GO:0042742 Biological process Defense response to bacterium IEA
GO:0002376 Biological process Immune system process IEA
GO:0001889 Biological process Liver development IDA
GO:2000296 Biological process Negative regulation of hydrogen peroxide catabolic process ISO
GO:0051354 Biological process Negative regulation of oxidoreductase activity ISO
GO:0007219 Biological process Notch signaling pathway ISO
GO:0010942 Biological process Positive regulation of cell death ISO
GO:0009617 Biological process Response to bacterium ISO
GO:0033590 Biological process Response to cobalamin IEP
GO:0051602 Biological process Response to electrical stimulus IEP
GO:0051384 Biological process Response to glucocorticoid IEP
GO:0060416 Biological process Response to growth hormone IEP
GO:0009408 Biological process Response to heat IEP
GO:0042542 Biological process Response to hydrogen peroxide ISO
GO:0001666 Biological process Response to hypoxia IEP
GO:0033591 Biological process Response to L-ascorbic acid IEP
GO:0010288 Biological process Response to lead ion IEP
GO:0032496 Biological process Response to lipopolysaccharide IEP
GO:0032026 Biological process Response to magnesium ion IEP
GO:0014070 Biological process Response to organic cyclic compound IEP
GO:0010033 Biological process Response to organic substance IEP
GO:0042594 Biological process Response to starvation IEP
GO:0010165 Biological process Response to X-ray IEP
GO:0009410 Biological process Response to xenobiotic stimulus IEP
GO:0007283 Biological process Spermatogenesis IEP
GO:0031638 Biological process Zymogen activation IBA
Length : 245
Sequence:
IIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAQNLFLNHSENATAKDIAPTL
TLYVGKNQLVEIEKVVLHPERSVVDIGLIKLKQKVLVTEKVMPICLPSKDYVAPGRMGYV
SGWGRNVNFRFTERLKYVMLPVADQEKCELHYEKSTVPEKKGAVSPVGVQPILNKHTFCA
GLTKYEEDTCYGDAGSAFAVHDTEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQE
TMAKN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India