CAMPSQ4174
Title : Preprochensinin-3Ka
GenInfo Identifier : 399143585
Source : Rana kukunoris [plateau brown frog]
Taxonomy : Animalia, Amphibia
UniProt: J7FJ46
Activity : Antimicrobial
Validated : Predicted
Comment : Unpublished
Pfam : PF03032 : FSAP_sig_propep ( Brevenin/esculentin/gaegurin/rugosin family )
InterPro : IPR004275 : Brevinin.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0050830 Biological process Defense response to Gram-positive bacterium IEA
GO:0006955 Biological process Immune response IEA
Length : 57
Sequence:
MFTLKKSLLLLFFLGTISLSLCEEERNAEEERRDYPEEKDVEVEKRIIPLPLGYFAK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India