| CAMPSQ4128 |
| Title : |
Antimicrobial peptide 3 |
| GenInfo Identifier : |
408387563 |
| Source : |
Taraxacum officinale [Common dandelion] |
| Taxonomy : |
Plantae |
| UniProt: |
B3EWQ3 |
| PubMed : |
22640720 |
| Activity : |
Antibacterial, Antifungal |
| Gram Nature : |
Gram +ve, Gram -ve |
| Target : |
P. syringae ( Inhibition zone=1.2cm at 6microg/ml ), B. subtilis ( Inhibition zone=0.8cm at 6microg/ml ) , X. campestris ( Inhibition zone=1.2cm at 6microg/ml ), F. oxysporum ( MIC=5.7microM ), A. niger ( MIC=1.2microM) |
| Validated : |
Experimentally validated |
| Gene Ontology : |
| GO ID |
Ontology |
Definition |
Evidence |
| GO:0050832 |
Biological process |
Defense response to fungus |
IDA |
| GO:0050829 |
Biological process |
Defense response to Gram-negative bacterium |
IDA |
| GO:0050830 |
Biological process |
Defense response to Gram-positive bacterium |
IDA |
| GO:0031640 |
Biological process |
Killing of cells of other organism |
IEA |
|
| Length : |
42 |
Sequence: |
ANKCIIDCMKVKTTCGDECKGAGFKTGGCALPPDIMKCCHNC |
