CAMPSQ4025
Title : Antimicrobial peptide
GenInfo Identifier : 410067123
Source : Chionodraco hamatus [Antarctic teleost icefish]
Taxonomy : Animalia, Pisces
UniProt: K4Q515
PubMed : 22982327
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
Psychrobacter sp. TAD1 (Temperature 15 degree c) ( MIC=10microM ), Psychrobacter sp. TA144 (Temperature 15 degree c) ( MIC=15microM ), Escherichia coli (Temperature 25 degree c) ( MIC=5microM ), Bacillus cereus (Temperature 25 degree c) ( MIC=5microM )
Hemolytic Activity :
Human erythrocytes 0.8% lysis ( 50microM )
Validated : Experimentally validated
Pfam : PF08107 : Antimicrobial12 ( Pleurocidin family )
InterPro : IPR012515 : Antimicrobial12.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological process Defense response to bacterium IEA
Length : 57
Sequence:
FFGHLYRGITSVVKHVHGLLSGETPRQQEVMKEAMREAMKVQEAMDQEAFDRERALV

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India