CAMPSQ3937
Title : Alpha-defensin PhD-4
Source : Papio hamadryas [Hamadryas baboon]
Taxonomy : Animalia, Mammals
UniProt: P86724
PubMed : 20155756
Activity : Antimicrobial
Validated : Experimentally validated
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
InterPro : IPR006080 : Defensin_beta/neutrophil.
IPR006081 : Mammalian_defensins.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinP30_10 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL]
DefensinH30_10 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0050832 Biological process Defense response to fungus IEA
GO:0031640 Biological process Killing of cells of other organism IEA
Length : 30
Sequence:
ACYCRIPACFAGERRYGTCFYLGRVWAFCC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India