CAMPSQ3912
Title : Bactridin-1
Source : Tityus discrepans [Venezuelan scorpion]
Taxonomy : Animalia, Arachnida
UniProt: P0CF39
PubMed : 19540868
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Bacillus subtilis, Micrococcus luteus, Enterococcus faecalis, Pseudomonas aeruginosa, Yersinia enterocolitica, Acinetobacter calcoaceticus
Validated : Experimentally validated
Pfam : PF00537 : Toxin_3 ( Scorpion toxin-like domain )
InterPro : IPR003614 : Scorpion_toxin-like.
IPR018218 : Scorpion_toxinL.
IPR002061 : Scorpion_toxinL/defesin.
AMP Family : Defensin
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IEA
GO:0019871 Molecular function Sodium channel inhibitor activity IEA
GO:0090729 Molecular function Toxin activity IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0044063 Biological process Modulation by symbiont of host nervous system process IEA
Length : 61
Sequence:
 KDGYIIEHRGCKYSCFFGTNSWCNTECTLKKGSSGYCAWPACWCYGLPDNVKIFDSNNLK
C

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India