CAMPSQ3886
Title : Histone H2B type 1-J
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P06899
PubMed : 11859126
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
Escherichia coli ( MIC = 10 microg/ml )
Validated : Experimentally validated
Pfam : PF00125 : Histone ( Core histone H2A/H2B/H3/H4 )
InterPro : IPR009072 : Histone-fold.
IPR009072 :
IPR007125 : Histone_core_D.
IPR007125 :
IPR000558 : Histone_H2B.
IPR000558 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0043505 Cellular component CENP-A containing nucleosome IPI
GO:0005829 Cellular component Cytosol IDA
GO:0005615 Cellular component Extracellular space IDA
GO:0005654 Cellular component Nucleoplasm IDA
GO:0000786 Cellular component Nucleosome IPI
GO:0005634 Cellular component Nucleus IDA
GO:0003677 Molecular function DNA binding IBA
GO:0001530 Molecular function Lipopolysaccharide binding IDA
GO:0046982 Molecular function Protein heterodimerization activity IEA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0002227 Biological process Innate immune response in mucosa IDA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0010804 Biological process Negative regulation of tumor necrosis factor-mediated signaling pathway IDA
GO:0006334 Biological process Nucleosome assembly IBA
Length : 125
Sequence:
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMG
IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSAK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India