CAMPSQ3884
Title : Histone H2A
Source : Litopenaeus vannamei [Whiteleg shrimp]
Taxonomy : Animalia, Crustaceans (Malacostraca)
UniProt: Q6PV61, P83865
PubMed : 15606770
Activity : Antibacterial
Gram Nature : Gram +ve
Target :
M. luteus ( MIC = 4.5 microM )
Validated : Experimentally validated
Pfam : PF00125 : Histone ( Core histone H2A/H2B/H3/H4 )
PF16211: Histone_H2A_C
PF15511: CENP-T_C
InterPro : IPR009072 : Histone-fold.
IPR007125 : Histone_core_D.
IPR002119 : Histone_H2A.
IPR001951 : Histone_H4.
IPR019809 : Histone_H4_CS.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0000786 Cellular component Nucleosome IEA
GO:0005634 Cellular component Nucleus IEA
GO:0003677 Molecular function DNA binding IEA
GO:0046982 Molecular function Protein heterodimerization activity IEA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0000786 Cellular component Nucleosome ISS
GO:0005634 Cellular component Nucleus IEA
GO:0003677 Molecular function DNA binding ISS
GO:0046982 Molecular function Protein heterodimerization activity IEA
GO:0042742 Biological process Defense response to bacterium IDA
GO:0006352 Biological process DNA-templated transcription, initiation IEA
GO:0006334 Biological process Nucleosome assembly ISS
Length : 122
Sequence:
 SGRGKGGKVKGKSKSRSSRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAE
VLELAGNAARDNKKTRIVPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTE
KK

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India