CAMPSQ3865
Title : Papillosin
Source : Halocynthia papillosa [Red sea-squirt]
Taxonomy : Animalia
UniProt: P86416
PubMed : 19085906
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
M.luteus, S.aureus, B.megaterium, A.viridans, E.faecalis, K.pneumoniae, E.coli DH5alpha, S.typhimurium, P.aeruginosa, E.aerogenes
Hemolytic Activity :
No hemolytic activity against sheep erythrocytes
Validated : Experimentally validated
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
Length : 34
Sequence:
 GFWKKVGSAAWGGVKAAAKGAAVGGLNALAKHIQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India