CAMPSQ3853
Title : Antimicrobial protein 1
Source : Scylla serrata [Mud crab]
Taxonomy : Animalia, Crustaceans (Malacostraca)
UniProt: A1YV58
PubMed : 19219229
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli ( MIC = 50 microg/ml), Pseudomonas aeruginosa ( MIC = 25 microg/ml ), Staphylococcus aureus ( MIC = 100 microg/ml), Streptococcus pyogenes ( MIC = 50 microg/ml )
Validated : Experimentally validated
Pfam : PF11630 : DUF3254 ( Protein of unknown function (DUF3254) )
InterPro : IPR024716 : Anti-LPS_factor.
IPR024509 : Anti-LPS_factor/Scygonadin.
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IDA
GO:0050829 Biological process Defense response to Gram-negative bacterium IDA
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
Length : 102
Sequence:
GQALNKLMPKIVSAIIYMIGQPNAGVTFLGHQCLVESTRQPDGFYTAKMWCTSWTSDNPI
VGEGRSRVELEALKGSIRNFVQTASDYKKFTIEEVEDWIASY

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India