CAMPSQ3830
Title : CCL27
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: Q9Y4X3
PDB: 2KUM
Structure Database : CAMPST631
PubMed : 12538707
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Pseudomonas aeruginosa ( IC50 > 10 microM ), Klebsiella pneumoniae ( IC50 > 10 microM ), Streptococcus mutans ( IC50 > 10 microM ), Streptococcus pyogenes ( IC50 > 10 microM ), Staphylococcus aureus( IC50 > 10 microM ), Candida albicans( IC50 = 5.0+/- 1.9 microM ), C. albicans ( IC50 = 5.0+/- 1.9 microM)
Validated : Experimentally validated
Pfam : PF00048 : IL8 ( Small cytokines (intecrine/chemokine), interleukin-8 like )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region IBA
GO:0005615 Cellular component Extracellular space IEA
GO:0031728 Molecular function CCR3 chemokine receptor binding IPI
GO:0008009 Molecular function Chemokine activity IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0007267 Biological process Cell-cell signaling TAS
GO:0006935 Biological process Chemotaxis TAS
GO:0006955 Biological process Immune response TAS
GO:0031640 Biological process Killing of cells of other organism IDA
GO:2000251 Biological process Positive regulation of actin cytoskeleton reorganization IBA
GO:0010820 Biological process Positive regulation of T cell chemotaxis IBA
Length : 56
Sequence:
PPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India