 |
| CAMPSQ3790 | |
| Title : | Oreoch-3 |
| Source : | Oreochromis niloticus [Nile tilapia] |
| Taxonomy : | Animalia, Pisces |
| PubMed : | Reference: Acostaa J, Monterob V, Carpioa Y, Velázqueza J, Garayc HE, Reyesc O, Cabralesc A, Masforrolc Y, Moralesa A, Estrada MP (2013) Cloning and functional characterization of three novel antimicrobial peptides from tilapia (Oreochromis niloticus). A |
| Activity : | Antibacterial, Antifungal |
| Validated : | Experimentally validated |
| Length : | 32 |
Sequence: |
IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ |
| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH | |