CAMPSQ376
Title : Neutrophil defensin 1
GenInfo Identifier : 38502875
Source : Macaca mulatta [Rhesus macaque]
Taxonomy : Animalia, Mammals
UniProt: P60030
PubMed : 10531277
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve, Gram -ve
Target :
L. monocytogenes, S. aureus, C. neoformans
Validated : Experimentally validated
Pfam : PF00323 : Defensin_1 ( Mammalian defensin )
PF00879 : Defensin_propep ( Defensin propeptide )
InterPro : IPR016327 : Alpha-defensin.
IPR006080 : Defensin_beta/neutrophil.
IPR002366 : Defensin_propep.
IPR006081 : Mammalian_defensins.
AMP Family : Defensin
Signature :
ID Type Pattern / HMM
DefensinP30_10 Pattern C-x(4)-C-x(4)-R-[QR]-x-G-T-C-[FIL]
DefensinH32_11 HMM
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0019731 Biological process Antibacterial humoral response IBA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0050832 Biological process Defense response to fungus IEA
GO:0050829 Biological process Defense response to Gram-negative bacterium IBA
GO:0050830 Biological process Defense response to Gram-positive bacterium IBA
GO:0002227 Biological process Innate immune response in mucosa IBA
GO:0031640 Biological process Killing of cells of other organism IEA
GO:0051673 Biological process Membrane disruption in other organism IBA
Length : 30
Sequence:
 ACYCRIPACLAGERRYGTCFYLGRVWAFCC

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India