CAMPSQ3747
Title : CCL13
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: Q99616
PDB: 2RA4
Structure Database : CAMPST625
PubMed : 12949249
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
Escherichia coli ATCC25922
Validated : Experimentally validated
Pfam : PF00048 : IL8 ( Small cytokines (intecrine/chemokine), interleukin-8 like )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IBA
GO:0048020 Molecular function CCR chemokine receptor binding IBA
GO:0008009 Molecular function Chemokine activity IDA
GO:0005102 Molecular function Signaling receptor binding TAS
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0007267 Biological process Cell-cell signaling TAS
GO:0006874 Biological process Cellular calcium ion homeostasis TAS
GO:0071346 Biological process Cellular response to interferon-gamma IBA
GO:0071347 Biological process Cellular response to interleukin-1 IBA
GO:0071356 Biological process Cellular response to tumor necrosis factor IBA
GO:0070098 Biological process Chemokine-mediated signaling pathway IBA
GO:0006935 Biological process Chemotaxis TAS
GO:0007010 Biological process Cytoskeleton organization IDA
GO:0048245 Biological process Eosinophil chemotaxis IDA
GO:0007186 Biological process G protein-coupled receptor signaling pathway IBA
GO:0006954 Biological process Inflammatory response IBA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0048247 Biological process Lymphocyte chemotaxis IBA
GO:0002548 Biological process Monocyte chemotaxis IBA
GO:0030593 Biological process Neutrophil chemotaxis IBA
GO:0070374 Biological process Positive regulation of ERK1 and ERK2 cascade IBA
GO:0043547 Biological process Positive regulation of GTPase activity IBA
GO:0008360 Biological process Regulation of cell shape IDA
GO:0007165 Biological process Signal transduction TAS
Length : 75
Sequence:
 QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQ
NYMKHLGRKAHTLKT

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India