CAMPSQ3745
Title : CCL8
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P80075
PDB: 1ESR
Structure Database : CAMPST623
PubMed : 12949249
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
Escherichia coli ATCC25922
Validated : Experimentally validated
Pfam : PF00048 : IL8 ( Small cytokines (intecrine/chemokine), interleukin-8 like )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005615 Cellular component Extracellular space IBA
GO:0048020 Molecular function CCR chemokine receptor binding IBA
GO:0031727 Molecular function CCR2 chemokine receptor binding IEA
GO:0008009 Molecular function Chemokine activity IBA
GO:0008201 Molecular function Heparin binding IEA
GO:0016004 Molecular function Phospholipase activator activity IDA
GO:0004672 Molecular function Protein kinase activity IDA
GO:0001525 Biological process Angiogenesis IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0006816 Biological process Calcium ion transport IDA
GO:0007267 Biological process Cell-cell signaling IDA
GO:0006874 Biological process Cellular calcium ion homeostasis IDA
GO:0071346 Biological process Cellular response to interferon-gamma IBA
GO:0071347 Biological process Cellular response to interleukin-1 IBA
GO:0071356 Biological process Cellular response to tumor necrosis factor IBA
GO:0070098 Biological process Chemokine-mediated signaling pathway IBA
GO:0006935 Biological process Chemotaxis TAS
GO:0048245 Biological process Eosinophil chemotaxis IBA
GO:0006887 Biological process Exocytosis IDA
GO:0007186 Biological process G protein-coupled receptor signaling pathway IBA
GO:0006954 Biological process Inflammatory response IBA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0048247 Biological process Lymphocyte chemotaxis IBA
GO:0002548 Biological process Monocyte chemotaxis IBA
GO:0044828 Biological process Negative regulation by host of viral genome replication IDA
GO:0070664 Biological process Negative regulation of leukocyte proliferation IEA
GO:0030593 Biological process Neutrophil chemotaxis IBA
GO:0070374 Biological process Positive regulation of ERK1 and ERK2 cascade IBA
GO:0043547 Biological process Positive regulation of GTPase activity IBA
GO:0002687 Biological process Positive regulation of leukocyte migration IEA
GO:0009615 Biological process Response to virus TAS
GO:0007165 Biological process Signal transduction TAS
Length : 75
Sequence:
 PDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVR
DSMKHLDQIFQNLKP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India