CAMPSQ3740
Title : CXCL11
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: O14625
PDB: 1RJT
Structure Database : CAMPST619
PubMed : 12949249
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Escherichia coli ATCC25922, Staphylococcus aureus ATCC29213
Validated : Experimentally validated
Pfam : PF00048 : IL8 ( Small cytokines (intecrine/chemokine), interleukin-8 like )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IBA
GO:0008009 Molecular function Chemokine activity IDA
GO:0045236 Molecular function CXCR chemokine receptor binding IBA
GO:0048248 Molecular function CXCR3 chemokine receptor binding IDA
GO:0008201 Molecular function Heparin binding IMP
GO:0007189 Biological process Adenylate cyclase-activating G protein-coupled receptor signaling pathway IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0007267 Biological process Cell-cell signaling TAS
GO:0071222 Biological process Cellular response to lipopolysaccharide IBA
GO:0070098 Biological process Chemokine-mediated signaling pathway IMP
GO:0006935 Biological process Chemotaxis IDA
GO:0006954 Biological process Inflammatory response IBA
GO:0031640 Biological process Killing of cells of other organism IDA
GO:0030593 Biological process Neutrophil chemotaxis IBA
GO:0051281 Biological process Positive regulation of release of sequestered calcium ion into cytosol IDA
GO:0042127 Biological process Regulation of cell population proliferation IMP
GO:0007165 Biological process Signal transduction TAS
GO:0010818 Biological process T cell chemotaxis IMP
Length : 73
Sequence:
 FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQ
ARLIIKKVERKNF

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India