CAMPSQ3731
Title : Psoriasin
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P31151
PDB: 2WND
Structure Database : CAMPST615
PubMed : 15568027
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
Escherichia coli
Validated : Experimentally validated
Pfam : PF01023 : S_100 ( S-100/ICaBP type calcium binding domain )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0035578 Cellular component Azurophil granule lumen TAS
GO:0062023 Cellular component Collagen-containing extracellular matrix HDA
GO:0005737 Cellular component Cytoplasm IDA
GO:0005829 Cellular component Cytosol IDA
GO:0005783 Cellular component Endoplasmic reticulum IDA
GO:0005576 Cellular component Extracellular region IDA
GO:0005615 Cellular component Extracellular space IDA
GO:0005925 Cellular component Focal adhesion NAS
GO:0005634 Cellular component Nucleus IDA
GO:0005509 Molecular function Calcium ion binding IDA
GO:0048306 Molecular function Calcium-dependent protein binding IBA
GO:0050786 Molecular function RAGE receptor binding IPI
GO:0008270 Molecular function Zinc ion binding NAS
GO:0001525 Biological process Angiogenesis NAS
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IMP
GO:0050829 Biological process Defense response to Gram-negative bacterium IMP
GO:0008544 Biological process Epidermis development TAS
GO:0045087 Biological process Innate immune response NAS
GO:0030216 Biological process Keratinocyte differentiation NAS
GO:0070374 Biological process Positive regulation of ERK1 and ERK2 cascade IDA
GO:0071624 Biological process Positive regulation of granulocyte chemotaxis IDA
GO:0090026 Biological process Positive regulation of monocyte chemotaxis IDA
GO:0010820 Biological process Positive regulation of T cell chemotaxis IDA
GO:0032496 Biological process Response to lipopolysaccharide IEP
GO:0000302 Biological process Response to reactive oxygen species IDA
GO:0051238 Biological process Sequestering of metal ion IDA
Length : 101
Sequence:
 MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFE
KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India