CAMPSQ3730
Title : RegIIIalpha
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: Q06141
PDB: 2GO0
Structure Database : CAMPST614
PubMed : 16931762
Activity : Antibacterial
Gram Nature : Gram +ve, Gram -ve
Target :
Listeria monocytogenes, Listeria innocua, Enterococcus faecalis, Escherichia coli
Validated : Experimentally validated
Pfam : PF00059 : Lectin_C ( Lectin C-type domain )
InterPro : IPR001304 : C-type_lectin.
IPR001304 :
IPR016186 : C-type_lectin-like.
IPR016186 :
IPR018378 : C-type_lectin_CS.
IPR018378 :
IPR016187 : C-type_lectin_fold.
IPR016187 :
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0005737 Cellular component Cytoplasm TAS
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IBA
GO:0030246 Molecular function Carbohydrate binding TAS
GO:0042802 Molecular function Identical protein binding IPI
GO:0070492 Molecular function Oligosaccharide binding IBA
GO:0042834 Molecular function Peptidoglycan binding IBA
GO:0038023 Molecular function Signaling receptor activity IBA
GO:0006953 Biological process Acute-phase response IEA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IBA
GO:0044278 Biological process Cell wall disruption in other organism IBA
GO:0007157 Biological process Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules TAS
GO:0045617 Biological process Negative regulation of keratinocyte differentiation ISS
GO:0008284 Biological process Positive regulation of cell population proliferation IBA
GO:0010838 Biological process Positive regulation of keratinocyte proliferation ISS
GO:0090303 Biological process Positive regulation of wound healing ISS
GO:0043434 Biological process Response to peptide hormone IBA
Length : 149
Sequence:
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGS
FVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHC
ASLSRSTAFLRWKDYNCNVRLPYVCKFTD

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India