CAMPSQ3726
Title : Human angiogenin
Source : Homo sapiens [Human]
Taxonomy : Animalia, Mammals
UniProt: P03950
PDB: 1B1I
Structure Database : CAMPST678
PubMed : 12548285
Activity : Antibacterial, Antifungal
Gram Nature : Gram +ve
Target :
Candida albicans, Streptococcus pneumoniae
Validated : Experimentally validated
Pfam : PF00074 : RnaseA ( Pancreatic ribonuclease )
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0015629 Cellular component Actin cytoskeleton IDA
GO:0032311 Cellular component Angiogenin-PRI complex IDA
GO:0005604 Cellular component Basement membrane IDA
GO:0005694 Cellular component Chromosome IDA
GO:0031410 Cellular component Cytoplasmic vesicle IEA
GO:0005829 Cellular component Cytosol TAS
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0030426 Cellular component Growth cone ISS
GO:0043025 Cellular component Neuronal cell body ISS
GO:0005730 Cellular component Nucleolus IDA
GO:0005634 Cellular component Nucleus IDA
GO:0003779 Molecular function Actin binding IDA
GO:0005507 Molecular function Copper ion binding IDA
GO:0003677 Molecular function DNA binding IC
GO:0004519 Molecular function Endonuclease activity TAS
GO:0004521 Molecular function Endoribonuclease activity TAS
GO:0008201 Molecular function Heparin binding IDA
GO:0042277 Molecular function Peptide binding IDA
GO:0042803 Molecular function Protein homodimerization activity IDA
GO:0004540 Molecular function Ribonuclease activity IDA
GO:0019843 Molecular function RRNA binding TAS
GO:0005102 Molecular function Signaling receptor binding IDA
GO:0030041 Biological process Actin filament polymerization ISS
GO:0032431 Biological process Activation of phospholipase A2 activity IMP
GO:0007202 Biological process Activation of phospholipase C activity IMP
GO:0032148 Biological process Activation of protein kinase B activity IMP
GO:0001525 Biological process Angiogenesis IDA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0019732 Biological process Antifungal humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0007154 Biological process Cell communication NAS
GO:0016477 Biological process Cell migration IMP
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0006651 Biological process Diacylglycerol biosynthetic process IDA
GO:0042592 Biological process Homeostatic process NAS
GO:0045087 Biological process Innate immune response IDA
GO:0048662 Biological process Negative regulation of smooth muscle cell proliferation IDA
GO:0017148 Biological process Negative regulation of translation IEA
GO:0001556 Biological process Oocyte maturation NAS
GO:0001541 Biological process Ovarian follicle development NAS
GO:0001890 Biological process Placenta development NAS
GO:0001938 Biological process Positive regulation of endothelial cell proliferation IDA
GO:0042327 Biological process Positive regulation of phosphorylation IDA
GO:0050714 Biological process Positive regulation of protein secretion IDA
GO:0009725 Biological process Response to hormone IDA
GO:0001666 Biological process Response to hypoxia IDA
GO:0001878 Biological process Response to yeast IDA
GO:0009303 Biological process RRNA transcription IMP
GO:0016078 Biological process TRNA catabolic process TAS
GO:0015629 Cellular component Actin cytoskeleton IDA
GO:0032311 Cellular component Angiogenin-PRI complex IDA
GO:0005604 Cellular component Basement membrane IDA
GO:0005694 Cellular component Chromosome IDA
GO:0031410 Cellular component Cytoplasmic vesicle IEA
GO:0005829 Cellular component Cytosol TAS
GO:0005576 Cellular component Extracellular region TAS
GO:0005615 Cellular component Extracellular space IDA
GO:0030426 Cellular component Growth cone ISS
GO:0043025 Cellular component Neuronal cell body ISS
GO:0005730 Cellular component Nucleolus IDA
GO:0005634 Cellular component Nucleus IDA
GO:0003779 Molecular function Actin binding IDA
GO:0005507 Molecular function Copper ion binding IDA
GO:0003677 Molecular function DNA binding IC
GO:0004519 Molecular function Endonuclease activity TAS
GO:0004521 Molecular function Endoribonuclease activity TAS
GO:0008201 Molecular function Heparin binding IDA
GO:0042277 Molecular function Peptide binding IDA
GO:0042803 Molecular function Protein homodimerization activity IDA
GO:0004540 Molecular function Ribonuclease activity IDA
GO:0019843 Molecular function RRNA binding TAS
GO:0005102 Molecular function Signaling receptor binding IDA
GO:0030041 Biological process Actin filament polymerization ISS
GO:0032431 Biological process Activation of phospholipase A2 activity IMP
GO:0007202 Biological process Activation of phospholipase C activity IMP
GO:0032148 Biological process Activation of protein kinase B activity IMP
GO:0001525 Biological process Angiogenesis IDA
GO:0019731 Biological process Antibacterial humoral response IDA
GO:0019732 Biological process Antifungal humoral response IDA
GO:0061844 Biological process Antimicrobial humoral immune response mediated by antimicrobial peptide IDA
GO:0007154 Biological process Cell communication NAS
GO:0016477 Biological process Cell migration IMP
GO:0050830 Biological process Defense response to Gram-positive bacterium IDA
GO:0006651 Biological process Diacylglycerol biosynthetic process IDA
GO:0042592 Biological process Homeostatic process NAS
GO:0045087 Biological process Innate immune response IDA
GO:0048662 Biological process Negative regulation of smooth muscle cell proliferation IDA
GO:0017148 Biological process Negative regulation of translation IEA
GO:0001556 Biological process Oocyte maturation NAS
GO:0001541 Biological process Ovarian follicle development NAS
GO:0001890 Biological process Placenta development NAS
GO:0001938 Biological process Positive regulation of endothelial cell proliferation IDA
GO:0042327 Biological process Positive regulation of phosphorylation IDA
GO:0050714 Biological process Positive regulation of protein secretion IDA
GO:0009725 Biological process Response to hormone IDA
GO:0001666 Biological process Response to hypoxia IDA
GO:0001878 Biological process Response to yeast IDA
GO:0009303 Biological process RRNA transcription IMP
GO:0016078 Biological process TRNA catabolic process TAS
Length : 125
Sequence:
 QDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGPTSPCKDINTFIHGNKRSIKAICENK
NGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIF
RRPRP

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India