CAMPSQ3497
Title : Cliotide T4, Cyclotide cter-P
GenInfo Identifier : 340002882, 347602404
Source : Clitoria ternatea [Butterfly pea]
Taxonomy : Plantae
UniProt: G1CWH3, P86902
PubMed : 21596752
Activity : Antibacterial
Gram Nature : Gram -ve
Target :
Escherichia coli ATCC 700926 ( MIC = 1.0 microM ), Klebsiella pneumonia ATCC 13883 ( MIC = 5.5 microM ), Pseudomonas aeruginosa ATCC 39018, ( MIC = 7.5 microM )
Hemolytic Activity :
Human erythrocytes ( HD50 = 8.4 microM )
Validated : Experimentally validated
Comment : Inactive against Staphylococcus aureus ATCC12600, Enterococcus faecalis ATCC 47077
Pfam : PF16720: Albumin_I_a
PF03784 : Cyclotide ( Cyclotide family )
AMP Family : Cyclotide
Signature :
ID Type Pattern / HMM
CyclotideH30_27 HMM
CyclotideH_67 HMM
CyclotideP30_27 Pattern C-[FV]-x-[GIL]-x-C-x-[STV]-[AGNPST]-x(3)-[CG]
Gene Ontology :
GO ID Ontology Definition
Evidence
GO:0042742 Biological process Defense response to bacterium IEA
GO:0044179 Biological process Hemolysis in other organism IEA
GO:0005576 Cellular component Extracellular region IEA
GO:0006952 Biological process Defense response IEA
GO:0042742 Biological process Defense response to bacterium IEA
GO:0044179 Biological process Hemolysis in other organism IEA
Length : 30
Sequence:
 GIPCGESCVFIPCITAAIGCSCKSKVCYRN

| © 2022, Biomedical Informatics Centre, ICMR-NIRRCH |
ICMR-National Institute for Research in Reproductive and Child Health, Jehangir Merwanji Street, Parel, Mumbai-400012
Maharashtra, India